Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like |
Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) binds cofactor molecules in the opposite direction than classical Rossmann fold |
Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (2 proteins) binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode automatically mapped to Pfam PF02233 |
Protein Transhydrogenase domain III (dIII) [52485] (3 species) |
Species Rhodospirillum rubrum [TaxId:1085] [52488] (15 PDB entries) |
Domain d1pnoa_: 1pno A: [94953] complexed with nap |
PDB Entry: 1pno (more details), 2.1 Å
SCOPe Domain Sequences for d1pnoa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pnoa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]} sghiegrhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsya ihpvagrmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdps spiygmpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn
Timeline for d1pnoa_: