SCOPe 2.03: Domain d1pnoa_: 1pno A:

Lineage for d1pnoa_ (1pno A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like

4. Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families)
   binds cofactor molecules in the opposite direction than classical Rossmann fold

5. Family c.31.1.4: Transhydrogenase domain III (dIII) [52484] (2 proteins)
   binds NADP, shares with the pyruvate oxidase FAD-binding domain a common ADP-binding mode
   automatically mapped to Pfam PF02233

6. Protein Transhydrogenase domain III (dIII) [52485] (3 species)

7. Species Rhodospirillum rubrum [TaxId:1085] [52488] (15 PDB entries)

8. Domain d1pnoa_: 1pno A: [94953]
   complexed with nap

Details for d1pnoa_

PDB Entry: 1pno, 2.1 Å

PDB Description: Crystal structure of R. rubrum transhydrogenase domain III bound to NADP

PDB Compounds: (A:) NAD(P) transhydrogenase subunit beta

SCOPe Domain Sequences for d1pnoa_:

Sequence; same for both SEQRES and ATOM records:

>d1pnoa_ c.31.1.4 (A:) Transhydrogenase domain III (dIII) {Rhodospirillum rubrum [TaxId: 1085]}
sghiegrhmagsaedaafimknaskviivpgygmavaqaqhalremadvlkkegvevsya
ihpvagrmpghmnvllaeanvpydevfeleeinssfqtadvafvigandvtnpaaktdps
spiygmpildvekagtvlfikrsmasgyagvenelffrnntmmlfgdakkmteqivqamn

Timeline for d1pnoa_:

• d1pnoa_ first appeared in SCOP 1.67
  
• d1pnoa_ appears in SCOPe 2.02
  
• d1pnoa_ appears in SCOPe 2.04
  
• d1pnoa_ appears in the current release, SCOPe 2.08, called d1pnoa1