Class a: All alpha proteins [46456] (290 folds) |
Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
Superfamily a.77.1: DEATH domain [47986] (5 families) |
Family a.77.1.5: Pyrin domain, PYD [101298] (3 proteins) automatically mapped to Pfam PF02758 |
Protein NALP1 [101301] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101302] (1 PDB entry) |
Domain d1pn5a1: 1pn5 A:59-151 [94948] |
PDB Entry: 1pn5 (more details)
SCOPe Domain Sequences for d1pn5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pn5a1 a.77.1.5 (A:59-151) NALP1 {Human (Homo sapiens) [TaxId: 9606]} maggawgrlacyleflkkeelkefqlllankahsrsssgetpaqpektsgmevasylvaq ygeqrawdlalhtweqmglrslcaqaqegaghs
Timeline for d1pn5a1: