Lineage for d1pn5a1 (1pn5 A:59-151)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718930Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2718931Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2719048Family a.77.1.5: Pyrin domain, PYD [101298] (3 proteins)
    automatically mapped to Pfam PF02758
  6. 2719052Protein NALP1 [101301] (1 species)
  7. 2719053Species Human (Homo sapiens) [TaxId:9606] [101302] (1 PDB entry)
  8. 2719054Domain d1pn5a1: 1pn5 A:59-151 [94948]

Details for d1pn5a1

PDB Entry: 1pn5 (more details)

PDB Description: nmr structure of the nalp1 pyrin domain (pyd)
PDB Compounds: (A:) NACHT-, LRR- and PYD-containing protein 2

SCOPe Domain Sequences for d1pn5a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn5a1 a.77.1.5 (A:59-151) NALP1 {Human (Homo sapiens) [TaxId: 9606]}
maggawgrlacyleflkkeelkefqlllankahsrsssgetpaqpektsgmevasylvaq
ygeqrawdlalhtweqmglrslcaqaqegaghs

SCOPe Domain Coordinates for d1pn5a1:

Click to download the PDB-style file with coordinates for d1pn5a1.
(The format of our PDB-style files is described here.)

Timeline for d1pn5a1: