Lineage for d1pn4b2 (1pn4 B:152-276)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943777Family d.38.1.4: MaoC-like [82636] (6 proteins)
  6. 2943782Protein 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase [102907] (2 species)
    duplication: consists of two MaoC-like domains; there is a greater structural divergence in the N-terminal domain
  7. 2943808Species Yeast (Candida tropicalis) [TaxId:5482] [102908] (2 PDB entries)
  8. 2943820Domain d1pn4b2: 1pn4 B:152-276 [94943]
    complexed with edo, hdc

Details for d1pn4b2

PDB Entry: 1pn4 (more details), 2.35 Å

PDB Description: crystal structure of 2-enoyl-coa hydratase 2 domain of candida tropicalis multifunctional enzyme type 2 complexed with (3r)- hydroxydecanoyl-coa.
PDB Compounds: (B:) Peroxisomal hydratase-dehydrogenase-epimerase

SCOPe Domain Sequences for d1pn4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn4b2 d.38.1.4 (B:152-276) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]}
nqflapkrapdyqvdvpvsedlaalyrlsgdrnplqidpnfakgakfpkpilhgmctygl
sakalidkfgmfneikarftgivfpgetlrvlawkesddtivfqthvvdrgtiainnaai
klvgd

SCOPe Domain Coordinates for d1pn4b2:

Click to download the PDB-style file with coordinates for d1pn4b2.
(The format of our PDB-style files is described here.)

Timeline for d1pn4b2: