SCOP 1.67: Domain d1pn4b1: 1pn4 B:5-151

Lineage for d1pn4b1 (1pn4 B:5-151)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (5 families)

5. Family d.38.1.4: MaoC-like [82636] (3 proteins)

6. Protein 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase [102907] (1 species)
   duplication: consists of two MaoC-like domains; there is a greater structural divergence in the N-terminal domain

7. Species Yeast (Candida tropicalis) [TaxId:5482] [102908] (2 PDB entries)

8. Domain d1pn4b1: 1pn4 B:5-151 [94942]

Details for d1pn4b1

PDB Entry: 1pn4, 2.35 Å

PDB Description: crystal structure of 2-enoyl-coa hydratase 2 domain of candida tropicalis multifunctional enzyme type 2 complexed with (3r)- hydroxydecanoyl-coa.

SCOP Domain Sequences for d1pn4b1:

Sequence; same for both SEQRES and ATOM records:

>d1pn4b1 d.38.1.4 (B:5-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis)}
pvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsgksqnsfakllr
nfnpmlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnksgeli
ysneatyfirncqadnkvyadrpafat

Timeline for d1pn4b1:

• d1pn4b1 is new in SCOP 1.67
  
• d1pn4b1 appears in SCOP 1.69
  
• d1pn4b1 appears in the current release, SCOPe 2.08