Lineage for d1pn4b1 (1pn4 B:5-151)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2167645Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2167646Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2167860Family d.38.1.4: MaoC-like [82636] (6 protein domains)
  6. 2167865Protein 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase [102907] (2 species)
    duplication: consists of two MaoC-like domains; there is a greater structural divergence in the N-terminal domain
  7. 2167891Species Yeast (Candida tropicalis) [TaxId:5482] [102908] (2 PDB entries)
  8. 2167902Domain d1pn4b1: 1pn4 B:5-151 [94942]
    complexed with edo, hdc

Details for d1pn4b1

PDB Entry: 1pn4 (more details), 2.35 Å

PDB Description: Crystal structure of 2-enoyl-CoA hydratase 2 domain of Candida tropicalis multifunctional enzyme type 2 complexed with (3R)-hydroxydecanoyl-CoA.
PDB Compounds: (B:) Peroxisomal hydratase-dehydrogenase-epimerase

SCOPe Domain Sequences for d1pn4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn4b1 d.38.1.4 (B:5-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]}
pvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsgksqnsfakllr
nfnpmlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnksgeli
ysneatyfirncqadnkvyadrpafat

SCOPe Domain Coordinates for d1pn4b1:

Click to download the PDB-style file with coordinates for d1pn4b1.
(The format of our PDB-style files is described here.)

Timeline for d1pn4b1: