Lineage for d1pn3b_ (1pn3 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142044Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2142045Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2142395Family c.87.1.5: Gtf glycosyltransferase [64178] (3 protein domains)
    Glycosyltransferase family 28
  6. 2142396Protein TDP-epi-vancosaminyltransferase GtfA [102680] (1 species)
  7. 2142397Species Amycolatopsis orientalis [TaxId:31958] [102681] (4 PDB entries)
  8. 2142401Domain d1pn3b_: 1pn3 B: [94939]
    complexed with bgc, tyd

Details for d1pn3b_

PDB Entry: 1pn3 (more details), 2.8 Å

PDB Description: crystal structure of tdp-epi-vancosaminyltransferase gtfa in complexes with tdp and the acceptor substrate dvv.
PDB Compounds: (B:) glycosyltransferase gtfa

SCOPe Domain Sequences for d1pn3b_:

Sequence, based on SEQRES records: (download)

>d1pn3b_ c.87.1.5 (B:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]}
mrvlitgcgsrgdteplvalaarlrelgadarmclppdyvercaevgvpmvpvgravrag
arepgelppgaaevvtevvaewfdkvpaaiegcdavvttgllpaavavrsmaeklgipyr
ytvlspdhlpseqsqaerdmynqgadrlfgdavnshrasiglppvehlydygytdqpwla
adpvlsplrptdlgtvqtgawilpderplsaeleaflaagstpvyvgfgsssrpatadaa
kmaikavrasgrrivlsrgwadlvlpddgadcfvvgevnlqelfgrvaaaihhdsagttl
lamragipqivvrrvvdnvveqayhadrvaelgvgvavdgpvptidslsaaldtalapei
rarattvadtiradgttvaaqllfdavslek

Sequence, based on observed residues (ATOM records): (download)

>d1pn3b_ c.87.1.5 (B:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]}
mrvlitgcgsrgdteplvalaarlrelgadarmclppdyvercaevgvpmvpvgravrag
arepgelppgaaevvtevvaewfdkvpaaiegcdavvttgllpaavavrsmaeklgipyr
ytvlspdhlpseqsqaerdmynqgadrlfgdavnshrasiglppvehlydygytdqpwla
adpvlsplrptdlgtvqtgawilpderplsaeleaflaagstpvyvgfgsssrpatadaa
kmaikavrasgrrivlsrgwadlvlpddgadcfvvgevnlqelfgrvaaaihhdsagttl
lamragipqivvrrvayhadrvaelgvgvavdgpvptidslsaaldtalapeirarattv
adtiradgttvaaqllfdavslek

SCOPe Domain Coordinates for d1pn3b_:

Click to download the PDB-style file with coordinates for d1pn3b_.
(The format of our PDB-style files is described here.)

Timeline for d1pn3b_: