SCOPe 2.07: Domain d1pn3a_: 1pn3 A:

Lineage for d1pn3a_ (1pn3 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
   consists of two non-similar domains with 3 layers (a/b/a) each
   domain 1: parallel beta-sheet of 7 strands, order 3214567
   domain 2: parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families)

5. Family c.87.1.5: Gtf glycosyltransferase [64178] (3 proteins)
   Glycosyltransferase family 28

6. Protein TDP-epi-vancosaminyltransferase GtfA [102680] (1 species)

7. Species Amycolatopsis orientalis [TaxId:31958] [102681] (4 PDB entries)

8. Domain d1pn3a_: 1pn3 A: [94938]
   complexed with bgc, tyd

Details for d1pn3a_

PDB Entry: 1pn3, 2.8 Å

PDB Description: crystal structure of tdp-epi-vancosaminyltransferase gtfa in complexes with tdp and the acceptor substrate dvv.

PDB Compounds: (A:) glycosyltransferase gtfa

SCOPe Domain Sequences for d1pn3a_:

Sequence; same for both SEQRES and ATOM records:

>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]}
mrvlitgcgsrgdteplvalaarlrelgadarmclppdyvercaevgvpmvpvgravrag
arepgelppgaaevvtevvaewfdkvpaaiegcdavvttgllpaavavrsmaeklgipyr
ytvlspdhlpseqsqaerdmynqgadrlfgdavnshrasiglppvehlydygytdqpwla
adpvlsplrptdlgtvqtgawilpderplsaeleaflaagstpvyvgfgsssrpatadaa
kmaikavrasgrrivlsrgwadlvlpddgadcfvvgevnlqelfgrvaaaihhdsagttl
lamragipqivvrrvvdnvveqayhadrvaelgvgvavdgpvptidslsaaldtalapei
rarattvadtiradgttvaaqllfdavslek

Timeline for d1pn3a_:

• d1pn3a_ first appeared in SCOP 1.67
  
• d1pn3a_ appears in SCOPe 2.06
  
• d1pn3a_ appears in the current release, SCOPe 2.08