Lineage for d1pn3a_ (1pn3 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 592686Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 592687Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (8 families) (S)
  5. 592853Family c.87.1.5: Gtf glycosyltransferase [64178] (3 proteins)
    Glycosyltransferase family 28
  6. 592854Protein TDP-epi-vancosaminyltransferase GtfA [102680] (1 species)
  7. 592855Species Amycolatopsis orientalis [TaxId:31958] [102681] (2 PDB entries)
  8. 592856Domain d1pn3a_: 1pn3 A: [94938]

Details for d1pn3a_

PDB Entry: 1pn3 (more details), 2.8 Å

PDB Description: crystal structure of tdp-epi-vancosaminyltransferase gtfa in complexes with tdp and the acceptor substrate dvv.

SCOP Domain Sequences for d1pn3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis}
mrvlitgcgsrgdteplvalaarlrelgadarmclppdyvercaevgvpmvpvgravrag
arepgelppgaaevvtevvaewfdkvpaaiegcdavvttgllpaavavrsmaeklgipyr
ytvlspdhlpseqsqaerdmynqgadrlfgdavnshrasiglppvehlydygytdqpwla
adpvlsplrptdlgtvqtgawilpderplsaeleaflaagstpvyvgfgsssrpatadaa
kmaikavrasgrrivlsrgwadlvlpddgadcfvvgevnlqelfgrvaaaihhdsagttl
lamragipqivvrrvvdnvveqayhadrvaelgvgvavdgpvptidslsaaldtalapei
rarattvadtiradgttvaaqllfdavslek

SCOP Domain Coordinates for d1pn3a_:

Click to download the PDB-style file with coordinates for d1pn3a_.
(The format of our PDB-style files is described here.)

Timeline for d1pn3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pn3b_