![]() | Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
![]() | Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily) consists of two non-similar domains with 3 layers (a/b/a) each domain 1: parallel beta-sheet of 7 strands, order 3214567 domain 2: parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (8 families) ![]() |
![]() | Family c.87.1.5: Gtf glycosyltransferase [64178] (3 proteins) Glycosyltransferase family 28 |
![]() | Protein TDP-epi-vancosaminyltransferase GtfA [102680] (1 species) |
![]() | Species Amycolatopsis orientalis [TaxId:31958] [102681] (2 PDB entries) |
![]() | Domain d1pn3a_: 1pn3 A: [94938] |
PDB Entry: 1pn3 (more details), 2.8 Å
SCOP Domain Sequences for d1pn3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis} mrvlitgcgsrgdteplvalaarlrelgadarmclppdyvercaevgvpmvpvgravrag arepgelppgaaevvtevvaewfdkvpaaiegcdavvttgllpaavavrsmaeklgipyr ytvlspdhlpseqsqaerdmynqgadrlfgdavnshrasiglppvehlydygytdqpwla adpvlsplrptdlgtvqtgawilpderplsaeleaflaagstpvyvgfgsssrpatadaa kmaikavrasgrrivlsrgwadlvlpddgadcfvvgevnlqelfgrvaaaihhdsagttl lamragipqivvrrvvdnvveqayhadrvaelgvgvavdgpvptidslsaaldtalapei rarattvadtiradgttvaaqllfdavslek
Timeline for d1pn3a_: