Lineage for d1pn3a_ (1pn3 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910507Fold c.87: UDP-Glycosyltransferase/glycogen phosphorylase [53755] (1 superfamily)
    consists of two non-similar domains with 3 layers (a/b/a) each
    domain 1: parallel beta-sheet of 7 strands, order 3214567
    domain 2: parallel beta-sheet of 6 strands, order 321456
  4. 2910508Superfamily c.87.1: UDP-Glycosyltransferase/glycogen phosphorylase [53756] (14 families) (S)
  5. 2910898Family c.87.1.5: Gtf glycosyltransferase [64178] (3 proteins)
    Glycosyltransferase family 28
  6. 2910899Protein TDP-epi-vancosaminyltransferase GtfA [102680] (1 species)
  7. 2910900Species Amycolatopsis orientalis [TaxId:31958] [102681] (4 PDB entries)
  8. 2910903Domain d1pn3a_: 1pn3 A: [94938]
    complexed with bgc, tyd

Details for d1pn3a_

PDB Entry: 1pn3 (more details), 2.8 Å

PDB Description: crystal structure of tdp-epi-vancosaminyltransferase gtfa in complexes with tdp and the acceptor substrate dvv.
PDB Compounds: (A:) glycosyltransferase gtfa

SCOPe Domain Sequences for d1pn3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]}
mrvlitgcgsrgdteplvalaarlrelgadarmclppdyvercaevgvpmvpvgravrag
arepgelppgaaevvtevvaewfdkvpaaiegcdavvttgllpaavavrsmaeklgipyr
ytvlspdhlpseqsqaerdmynqgadrlfgdavnshrasiglppvehlydygytdqpwla
adpvlsplrptdlgtvqtgawilpderplsaeleaflaagstpvyvgfgsssrpatadaa
kmaikavrasgrrivlsrgwadlvlpddgadcfvvgevnlqelfgrvaaaihhdsagttl
lamragipqivvrrvvdnvveqayhadrvaelgvgvavdgpvptidslsaaldtalapei
rarattvadtiradgttvaaqllfdavslek

SCOPe Domain Coordinates for d1pn3a_:

Click to download the PDB-style file with coordinates for d1pn3a_.
(The format of our PDB-style files is described here.)

Timeline for d1pn3a_: