SCOPe 2.08: Domain d1pn2c2: 1pn2 C:152-275

Lineage for d1pn2c2 (1pn2 C:152-275)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families)

5. Family d.38.1.4: MaoC-like [82636] (6 proteins)

6. Protein 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase [102907] (2 species)
   duplication: consists of two MaoC-like domains; there is a greater structural divergence in the N-terminal domain

7. Species Yeast (Candida tropicalis) [TaxId:5482] [102908] (2 PDB entries)

8. Domain d1pn2c2: 1pn2 C:152-275 [94935]
   complexed with edo

Details for d1pn2c2

PDB Entry: 1pn2, 1.95 Å

PDB Description: crystal structure analysis of the selenomethionine labelled 2-enoyl- coa hydratase 2 domain of candida tropicalis multifunctional enzyme type 2

PDB Compounds: (C:) Peroxisomal hydratase-dehydrogenase-epimerase

SCOPe Domain Sequences for d1pn2c2:

Sequence; same for both SEQRES and ATOM records:

>d1pn2c2 d.38.1.4 (C:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]}
nqflapkrapdyqvdvpvsedlaalyrlsgdrnplhidpnfakgakfpkpilhgmctygl
sakalidkfgmfneikarftgivfpgetlrvlawkesddtivfqthvvdrgtiainnaai
klvg

Timeline for d1pn2c2:

• d1pn2c2 first appeared in SCOP 1.67
  
• d1pn2c2 appears in SCOPe 2.07