![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) ![]() |
![]() | Family d.38.1.4: MaoC-like [82636] (6 proteins) |
![]() | Protein 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase [102907] (2 species) duplication: consists of two MaoC-like domains; there is a greater structural divergence in the N-terminal domain |
![]() | Species Yeast (Candida tropicalis) [TaxId:5482] [102908] (2 PDB entries) |
![]() | Domain d1pn2c1: 1pn2 C:5-151 [94934] complexed with edo |
PDB Entry: 1pn2 (more details), 1.95 Å
SCOPe Domain Sequences for d1pn2c1:
Sequence, based on SEQRES records: (download)
>d1pn2c1 d.38.1.4 (C:5-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} pvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsgksqnsfakllr nfnpmlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnksgeli ysneatyfirncqadnkvyadrpafat
>d1pn2c1 d.38.1.4 (C:5-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]} pvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsnsfakllrnfnp mlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnksgeliysne atyfirncqadnkvyadrpafat
Timeline for d1pn2c1: