SCOP 1.75: Domain d1pn2b2: 1pn2 B:152-274

Lineage for d1pn2b2 (1pn2 B:152-274)

Root: SCOP 1.75
Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
core: beta-alpha-beta(4); 2 layers: alpha/beta
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families)
Family d.38.1.4: MaoC-like [82636] (6 proteins)

Protein 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase [102907] (2 species)
duplication: consists of two MaoC-like domains; there is a greater structural divergence in the N-terminal domain

Species Yeast (Candida tropicalis) [TaxId:5482] [102908] (2 PDB entries)
Domain d1pn2b2: 1pn2 B:152-274 [94933]

Details for d1pn2b2

PDB Entry: 1pn2 (more details), 1.95 Å

PDB Description: crystal structure analysis of the selenomethionine labelled 2-enoyl- coa hydratase 2 domain of candida tropicalis multifunctional enzyme type 2

PDB Compounds: (B:) Peroxisomal hydratase-dehydrogenase-epimerase

SCOP Domain Sequences for d1pn2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn2b2 d.38.1.4 (B:152-274) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]}
nqflapkrapdyqvdvpvsedlaalyrlsgdrnplhidpnfakgakfpkpilhgmctygl
sakalidkfgmfneikarftgivfpgetlrvlawkesddtivfqthvvdrgtiainnaai
klv

SCOP Domain Coordinates for d1pn2b2:

Click to download the PDB-style file with coordinates for d1pn2b2.
(The format of our PDB-style files is described here.)

Timeline for d1pn2b2: