Lineage for d1pn2a2 (1pn2 A:152-275)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 502577Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 502578Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (6 families) (S)
  5. 502620Family d.38.1.4: MaoC-like [82636] (3 proteins)
  6. 502625Protein 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase [102907] (1 species)
    duplication: consists of two MaoC-like domains; there is a greater structural divergence in the N-terminal domain
  7. 502626Species Yeast (Candida tropicalis) [TaxId:5482] [102908] (2 PDB entries)
  8. 502628Domain d1pn2a2: 1pn2 A:152-275 [94931]

Details for d1pn2a2

PDB Entry: 1pn2 (more details), 1.95 Å

PDB Description: crystal structure analysis of the selenomethionine labelled 2-enoyl- coa hydratase 2 domain of candida tropicalis multifunctional enzyme type 2

SCOP Domain Sequences for d1pn2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis)}
nqflapkrapdyqvdvpvsedlaalyrlsgdrnplhidpnfakgakfpkpilhgmctygl
sakalidkfgmfneikarftgivfpgetlrvlawkesddtivfqthvvdrgtiainnaai
klvg

SCOP Domain Coordinates for d1pn2a2:

Click to download the PDB-style file with coordinates for d1pn2a2.
(The format of our PDB-style files is described here.)

Timeline for d1pn2a2: