Lineage for d1pn2a2 (1pn2 A:152-275)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. Family d.38.1.4: MaoC-like [82636] (6 proteins)
  6. Protein 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase [102907] (2 species)
    duplication: consists of two MaoC-like domains; there is a greater structural divergence in the N-terminal domain
  7. Species Yeast (Candida tropicalis) [TaxId:5482] [102908] (2 PDB entries)
  8. Domain d1pn2a2: 1pn2 A:152-275 [94931]
    complexed with edo

Details for d1pn2a2

PDB Entry: 1pn2 (more details), 1.95 Å

PDB Description: Crystal structure analysis of the selenomethionine labelled 2-enoyl-CoA hydratase 2 domain of Candida tropicalis multifunctional enzyme type 2
PDB Compounds: (A:) Peroxisomal hydratase-dehydrogenase-epimerase

SCOPe Domain Sequences for d1pn2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn2a2 d.38.1.4 (A:152-275) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]}
nqflapkrapdyqvdvpvsedlaalyrlsgdrnplhidpnfakgakfpkpilhgmctygl
sakalidkfgmfneikarftgivfpgetlrvlawkesddtivfqthvvdrgtiainnaai
klvg

SCOPe Domain Coordinates for d1pn2a2 are not available.

Timeline for d1pn2a2:

Domains from same chain:
(mouse over for more information)
d1pn2a1
Domains from other chains:
(mouse over for more information)
d1pn2b1, d1pn2b2, d1pn2c1, d1pn2c2, d1pn2d1, d1pn2d2