Lineage for d1pn2a1 (1pn2 A:4-151)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1646047Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 1646048Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 1646251Family d.38.1.4: MaoC-like [82636] (6 proteins)
  6. 1646256Protein 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase [102907] (2 species)
    duplication: consists of two MaoC-like domains; there is a greater structural divergence in the N-terminal domain
  7. 1646282Species Yeast (Candida tropicalis) [TaxId:5482] [102908] (2 PDB entries)
  8. 1646283Domain d1pn2a1: 1pn2 A:4-151 [94930]
    complexed with edo

Details for d1pn2a1

PDB Entry: 1pn2 (more details), 1.95 Å

PDB Description: crystal structure analysis of the selenomethionine labelled 2-enoyl- coa hydratase 2 domain of candida tropicalis multifunctional enzyme type 2
PDB Compounds: (A:) Peroxisomal hydratase-dehydrogenase-epimerase

SCOPe Domain Sequences for d1pn2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn2a1 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]}
dpvwrfddrdvilynialgattkqlkyvyendsdfqviptfghlitfnsgksqnsfakll
rnfnpmlllhgehylkvhswppptegeikttfepiattpkgtnvvivhgsksvdnksgel
iysneatyfirncqadnkvyadrpafat

SCOPe Domain Coordinates for d1pn2a1:

Click to download the PDB-style file with coordinates for d1pn2a1.
(The format of our PDB-style files is described here.)

Timeline for d1pn2a1: