Lineage for d1pn0d1 (1pn0 D:1-240,D:342-461)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1832628Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1832629Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1832683Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins)
    C-terminal domain is alpha+beta is common for the family
  6. 1832933Protein Phenol hydroxylase [51922] (1 species)
    structurally very similar to PHBH, but contains additional C-terminal domain of the thioredoxin-like fold
  7. 1832934Species Soil-living yeast (Trichosporon cutaneum) [TaxId:5554] [51923] (2 PDB entries)
  8. 1832938Domain d1pn0d1: 1pn0 D:1-240,D:342-461 [94927]
    Other proteins in same PDB: d1pn0a2, d1pn0a3, d1pn0b2, d1pn0b3, d1pn0c2, d1pn0c3, d1pn0d2, d1pn0d3
    complexed with cl, fad, iph

Details for d1pn0d1

PDB Entry: 1pn0 (more details), 1.7 Å

PDB Description: Phenol hydroxylase from Trichosporon cutaneum
PDB Compounds: (D:) Phenol 2-monooxygenase

SCOPe Domain Sequences for d1pn0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn0d1 c.3.1.2 (D:1-240,D:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]}
tkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcrt
leslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgri
errildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsedestplqfg
hktenglfrsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfemi
Xvtekfskdervfiagdachthspkagqgmntsmmdtynlgwklglvltgrakrdilkty
eeerqpfaqalidfdhqfsrlfsgrpakdvademgvsmdvfkeafvkgnefasgtainyd
e

SCOPe Domain Coordinates for d1pn0d1:

Click to download the PDB-style file with coordinates for d1pn0d1.
(The format of our PDB-style files is described here.)

Timeline for d1pn0d1: