Lineage for d1pn0c2 (1pn0 C:462-662)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1853530Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 1853704Protein Phenol hydroxylase, C-terminal domain [52911] (1 species)
  7. 1853705Species Soil-living yeast (Trichosporon cutaneum) [TaxId:5554] [52912] (2 PDB entries)
  8. 1853708Domain d1pn0c2: 1pn0 C:462-662 [94925]
    Other proteins in same PDB: d1pn0a1, d1pn0a3, d1pn0b1, d1pn0b3, d1pn0c1, d1pn0c3, d1pn0d1, d1pn0d3
    complexed with cl, fad, iph

Details for d1pn0c2

PDB Entry: 1pn0 (more details), 1.7 Å

PDB Description: Phenol hydroxylase from Trichosporon cutaneum
PDB Compounds: (C:) Phenol 2-monooxygenase

SCOPe Domain Sequences for d1pn0c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pn0c2 c.47.1.10 (C:462-662) Phenol hydroxylase, C-terminal domain {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]}
nlvtdkksskqelakncvvgtrfksqpvvrhseglwmhfgdrlvtdgrfriivfagkatd
atqmsrikkfaayldsensvisrytpkgadrnsridvitihschrddiemhdfpapalhp
kwqydfiyadcdswhhphpksyqawgvdetkgavvvvrpdgytslvtdlegtaeidryfs
gilvepkeksgaqteadwtks

SCOPe Domain Coordinates for d1pn0c2:

Click to download the PDB-style file with coordinates for d1pn0c2.
(The format of our PDB-style files is described here.)

Timeline for d1pn0c2: