![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
![]() | Protein Phenol hydroxylase, C-terminal domain [52911] (1 species) |
![]() | Species Soil-living yeast (Trichosporon cutaneum) [TaxId:5554] [52912] (2 PDB entries) |
![]() | Domain d1pn0b2: 1pn0 B:462-662 [94922] Other proteins in same PDB: d1pn0a1, d1pn0a3, d1pn0b1, d1pn0b3, d1pn0c1, d1pn0c3, d1pn0d1, d1pn0d3 complexed with cl, fad, iph |
PDB Entry: 1pn0 (more details), 1.7 Å
SCOPe Domain Sequences for d1pn0b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pn0b2 c.47.1.10 (B:462-662) Phenol hydroxylase, C-terminal domain {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} nlvtdkksskqelakncvvgtrfksqpvvrhseglwmhfgdrlvtdgrfriivfagkatd atqmsrikkfaayldsensvisrytpkgadrnsridvitihschrddiemhdfpapalhp kwqydfiyadcdswhhphpksyqawgvdetkgavvvvrpdgytslvtdlegtaeidryfs gilvepkeksgaqteadwtks
Timeline for d1pn0b2: