Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) |
Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 proteins) C-terminal domain is alpha+beta is common for the family |
Protein Phenol hydroxylase [51922] (1 species) structurally very similar to PHBH, but contains additional C-terminal domain of the thioredoxin-like fold |
Species Soil-living yeast (Trichosporon cutaneum) [TaxId:5554] [51923] (2 PDB entries) |
Domain d1pn0b1: 1pn0 B:1-240,B:342-461 [94921] Other proteins in same PDB: d1pn0a2, d1pn0a3, d1pn0b2, d1pn0b3, d1pn0c2, d1pn0c3, d1pn0d2, d1pn0d3 complexed with cl, fad, iph |
PDB Entry: 1pn0 (more details), 1.7 Å
SCOPe Domain Sequences for d1pn0b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pn0b1 c.3.1.2 (B:1-240,B:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} tkysesycdvlivgagpaglmaarvlseyvrqkpdlkvriidkrstkvyngqadglqcrt leslknlgladkilseandmstialynpdenghirrtdripdtlpgisryhqvvlhqgri errildsiaeisdtrikverplipekmeidsskaedpeaypvtmtlrymsedestplqfg hktenglfrsnlqtqeeedanyrlpegkeageietvhckyvigcdgghswvrrtlgfemi Xvtekfskdervfiagdachthspkagqgmntsmmdtynlgwklglvltgrakrdilkty eeerqpfaqalidfdhqfsrlfsgrpakdvademgvsmdvfkeafvkgnefasgtainyd e
Timeline for d1pn0b1: