Lineage for d1pmxa_ (1pmx A:)

  1. Root: SCOPe 2.01
  2. 1061255Class g: Small proteins [56992] (90 folds)
  3. 1061256Fold g.1: Insulin-like [56993] (1 superfamily)
    nearly all-alpha
    can be classified as disulfide-rich
  4. 1061257Superfamily g.1.1: Insulin-like [56994] (1 family) (S)
  5. 1061258Family g.1.1.1: Insulin-like [56995] (5 proteins)
  6. 1061478Protein Insulin-like growth factor [57002] (1 species)
  7. 1061479Species Human (Homo sapiens) [TaxId:9606] [57003] (19 PDB entries)
    Uniprot P05019 49-110
  8. 1061493Domain d1pmxa_: 1pmx A: [94917]
    bound to a phage-derived peptide, chain B

Details for d1pmxa_

PDB Entry: 1pmx (more details)

PDB Description: insulin-like growth factor-i bound to a phage-derived peptide
PDB Compounds: (A:) Insulin-like growth factor IB

SCOPe Domain Sequences for d1pmxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmxa_ g.1.1.1 (A:) Insulin-like growth factor {Human (Homo sapiens) [TaxId: 9606]}
gpetlcgaelvdalqfvcgdrgfyfnkptgygsssrrapqtgivdeccfrscdlrrlemy
caplkpaksa

SCOPe Domain Coordinates for d1pmxa_:

Click to download the PDB-style file with coordinates for d1pmxa_.
(The format of our PDB-style files is described here.)

Timeline for d1pmxa_: