Lineage for d1pmob_ (1pmo B:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 399758Fold c.67: PLP-dependent transferases [53382] (1 superfamily)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 399759Superfamily c.67.1: PLP-dependent transferases [53383] (6 families) (S)
  5. 400321Family c.67.1.6: Pyridoxal-dependent decarboxylase [69565] (2 proteins)
  6. 400328Protein Glutamate decarboxylase beta, GadB [102596] (1 species)
  7. 400329Species Escherichia coli [TaxId:562] [102597] (2 PDB entries)
  8. 400337Domain d1pmob_: 1pmo B: [94909]

Details for d1pmob_

PDB Entry: 1pmo (more details), 2.3 Å

PDB Description: Crystal structure of Escherichia coli GadB (neutral pH)

SCOP Domain Sequences for d1pmob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pmob_ c.67.1.6 (B:) Glutamate decarboxylase beta, GadB {Escherichia coli}
kqvtdlrselldsrfgaksistiaeskrfplhemrddvafqiindelyldgnarqnlatf
cqtwddenvhklmdlsinknwidkeeypqsaaidlrcvnmvadlwhapapkngqavgtnt
igsseacmlggmamkwrwrkrmeaagkptdkpnlvcgpvqicwhkfarywdvelreipmr
pgqlfmdpkrmieacdentigvvptfgvtytgnyefpqplhdaldkfqadtgididmhid
aasggflapfvapdivwdfrlprvksisasghkfglaplgcgwviwrdeealpqelvfnv
dylggqigtfainfsrpagqviaqyyeflrlgregytkvqnasyqvaayladeiaklgpy
efictgrpdegipavcfklkdgedpgytlydlserlrlrgwqvpaftlggeatdivvmri
mcrrgfemdfaellledykaslkylsdhpklqgiaqqnsfkht

SCOP Domain Coordinates for d1pmob_:

Click to download the PDB-style file with coordinates for d1pmob_.
(The format of our PDB-style files is described here.)

Timeline for d1pmob_: