SCOPe 2.03: Domain d1pm9b1: 1pm9 B:1-83

Lineage for d1pm9b1 (1pm9 B:1-83)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46619] (27 PDB entries)

8. Domain d1pm9b1: 1pm9 B:1-83 [94899]
   Other proteins in same PDB: d1pm9a2, d1pm9b2
   complexed with mn3; mutant

Details for d1pm9b1

PDB Entry: 1pm9, 1.7 Å

PDB Description: crystal structure of human mnsod h30n, y166f mutant

PDB Compounds: (B:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d1pm9b1:

Sequence; same for both SEQRES and ATOM records:

>d1pm9b1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhsknhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

Timeline for d1pm9b1:

• d1pm9b1 first appeared in SCOP 1.67
  
• d1pm9b1 appears in SCOPe 2.02
  
• d1pm9b1 appears in SCOPe 2.04
  
• d1pm9b1 appears in the current release, SCOPe 2.08