Lineage for d1pm7b_ (1pm7 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1807020Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 1807021Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 1807022Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins)
  6. 1807023Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species)
    synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase
  7. 1807027Species Mycobacterium tuberculosis [TaxId:1773] [101971] (3 PDB entries)
  8. 1807034Domain d1pm7b_: 1pm7 B: [94896]
    complexed with act, gol

Details for d1pm7b_

PDB Entry: 1pm7 (more details), 2.2 Å

PDB Description: rmlc (dtdp-6-deoxy-d-xylo-4-hexulose 3,5-epimerase)structure from mycobacterium tuberculosis and inhibitor design. the apo structure.
PDB Compounds: (B:) rfbc

SCOPe Domain Sequences for d1pm7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pm7b_ b.82.1.1 (B:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]}
mkareldvpgaweitptihvdsrglffewltdhgfrafaghsldvrqvncsvssagvlrg
lhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwdsvllddqdrrtiyvseglahg
flalqdnstvmylcsaeynpqrehticatdptlavdwplvdgaapslsdrdaaapsfedv
rasgllprweqtqrfigem

SCOPe Domain Coordinates for d1pm7b_:

Click to download the PDB-style file with coordinates for d1pm7b_.
(The format of our PDB-style files is described here.)

Timeline for d1pm7b_: