![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.1: dTDP-sugar isomerase [51183] (5 proteins) |
![]() | Protein dTDP-4-dehydrorhamnose 3,5-epimerase RmlC [51184] (6 species) synonym: dTDP-6-deoxy-D-xylo-4-hexulose 3,5-epimerase |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [101971] (3 PDB entries) |
![]() | Domain d1pm7a_: 1pm7 A: [94895] complexed with act, gol |
PDB Entry: 1pm7 (more details), 2.2 Å
SCOPe Domain Sequences for d1pm7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pm7a_ b.82.1.1 (A:) dTDP-4-dehydrorhamnose 3,5-epimerase RmlC {Mycobacterium tuberculosis [TaxId: 1773]} mkareldvpgaweitptihvdsrglffewltdhgfrafaghsldvrqvncsvssagvlrg lhfaqlppsqakyvtcvsgsvfdvvvdiregsptfgrwdsvllddqdrrtiyvseglahg flalqdnstvmylcsaeynpqrehticatdptlavdwplvdgaapslsdrdaaapsfedv rasgllprweqtqrfigem
Timeline for d1pm7a_: