| Class a: All alpha proteins [46456] (226 folds) |
| Fold a.6: Putative DNA-binding domain [46954] (1 superfamily) core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different |
Superfamily a.6.1: Putative DNA-binding domain [46955] (7 families) ![]() |
| Family a.6.1.7: Excisionase-like [46891] (2 proteins) kinked C-terminal helix |
| Protein Excisionase Xis [89004] (1 species) |
| Species Bacteriophage lambda [TaxId:10710] [89005] (3 PDB entries) |
| Domain d1pm6a_: 1pm6 A: [94894] mutant |
PDB Entry: 1pm6 (more details)
SCOP Domain Sequences for d1pm6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pm6a_ a.6.1.7 (A:) Excisionase Xis {Bacteriophage lambda}
myltlqewnarqrrprsletvrrwvresrifpppvkdgreylfhesavkvdlnrpvtgsl
lkrirngkkaks
Timeline for d1pm6a_: