Lineage for d1pm4c_ (1pm4 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2824637Fold b.135: Superantigen (mitogen) Ypm [101605] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2824638Superfamily b.135.1: Superantigen (mitogen) Ypm [101606] (1 family) (S)
    automatically mapped to Pfam PF09144
  5. 2824639Family b.135.1.1: Superantigen (mitogen) Ypm [101607] (1 protein)
  6. 2824640Protein Superantigen (mitogen) Ypm [101608] (1 species)
  7. 2824641Species Yersinia pseudotuberculosis [TaxId:633] [101609] (2 PDB entries)
  8. 2824644Domain d1pm4c_: 1pm4 C: [94893]

Details for d1pm4c_

PDB Entry: 1pm4 (more details), 1.75 Å

PDB Description: Crystal structure of Yersinia pseudotuberculosis-derived mitogen (YPM)
PDB Compounds: (C:) ypm

SCOPe Domain Sequences for d1pm4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pm4c_ b.135.1.1 (C:) Superantigen (mitogen) Ypm {Yersinia pseudotuberculosis [TaxId: 633]}
ipniatytgtiqgkgevciignkegktrggelyavlhstnvnadmtlillrnvggngwge
ikrndidkplkyedyytsglswiwkiknnssetsnysldatvhddkedsdvltkcpv

SCOPe Domain Coordinates for d1pm4c_:

Click to download the PDB-style file with coordinates for d1pm4c_.
(The format of our PDB-style files is described here.)

Timeline for d1pm4c_: