![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.135: Superantigen (mitogen) Ypm [101605] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.135.1: Superantigen (mitogen) Ypm [101606] (1 family) ![]() automatically mapped to Pfam PF09144 |
![]() | Family b.135.1.1: Superantigen (mitogen) Ypm [101607] (1 protein) |
![]() | Protein Superantigen (mitogen) Ypm [101608] (1 species) |
![]() | Species Yersinia pseudotuberculosis [TaxId:633] [101609] (2 PDB entries) |
![]() | Domain d1pm4a_: 1pm4 A: [94891] |
PDB Entry: 1pm4 (more details), 1.75 Å
SCOPe Domain Sequences for d1pm4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pm4a_ b.135.1.1 (A:) Superantigen (mitogen) Ypm {Yersinia pseudotuberculosis [TaxId: 633]} ipniatytgtiqgkgevciignkegktrggelyavlhstnvnadmtlillrnvggngwge ikrndidkplkyedyytsglswiwkiknnssetsnysldatvhddkedsdvltkcpv
Timeline for d1pm4a_: