Class b: All beta proteins [48724] (176 folds) |
Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
Superfamily b.41.1: PRC-barrel domain [50346] (5 families) |
Family b.41.1.2: MTH1895 [101773] (1 protein) homodimeric protein; subunits are composed of a stand-alone copy of this domain automatically mapped to Pfam PF05239 |
Protein MTH1895 [101774] (1 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [101775] (1 PDB entry) |
Domain d1pm3b_: 1pm3 B: [94890] structural genomics |
PDB Entry: 1pm3 (more details), 3.15 Å
SCOPe Domain Sequences for d1pm3b_:
Sequence, based on SEQRES records: (download)
>d1pm3b_ b.41.1.2 (B:) MTH1895 {Methanobacterium thermoautotrophicum [TaxId: 145262]} hmriveemvgkevldssakvigkvkdvevdiesqaieslvlgkggiseglglskgetivp yemvkkigdkillkgpe
>d1pm3b_ b.41.1.2 (B:) MTH1895 {Methanobacterium thermoautotrophicum [TaxId: 145262]} hmriveemvgkevldssakvigkvkdvevdiesqaieslvlgkgkgetivpyemvkkigd killkgpe
Timeline for d1pm3b_: