Lineage for d1pm3b_ (1pm3 B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 375249Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 375250Superfamily b.41.1: PRC-barrel domain [50346] (2 families) (S)
  5. 375312Family b.41.1.2: MTH1895 [101773] (1 protein)
    homodimeric protein; subunits are composed of a stand-alone copy of this domain
  6. 375313Protein MTH1895 [101774] (1 species)
  7. 375314Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [101775] (1 PDB entry)
  8. 375316Domain d1pm3b_: 1pm3 B: [94890]
    structural genomics

Details for d1pm3b_

PDB Entry: 1pm3 (more details), 3.15 Å

PDB Description: mth1859

SCOP Domain Sequences for d1pm3b_:

Sequence, based on SEQRES records: (download)

>d1pm3b_ b.41.1.2 (B:) MTH1895 {Archaeon Methanobacterium thermoautotrophicum}
hmriveemvgkevldssakvigkvkdvevdiesqaieslvlgkggiseglglskgetivp
yemvkkigdkillkgpe

Sequence, based on observed residues (ATOM records): (download)

>d1pm3b_ b.41.1.2 (B:) MTH1895 {Archaeon Methanobacterium thermoautotrophicum}
hmriveemvgkevldssakvigkvkdvevdiesqaieslvlgkgkgetivpyemvkkigd
killkgpe

SCOP Domain Coordinates for d1pm3b_:

Click to download the PDB-style file with coordinates for d1pm3b_.
(The format of our PDB-style files is described here.)

Timeline for d1pm3b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pm3a_