Lineage for d1pm3b1 (1pm3 B:1-76)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2791427Fold b.41: PRC-barrel domain [50345] (1 superfamily)
    core: barrel, partly opened; n*=5, S*=8; meander
  4. 2791428Superfamily b.41.1: PRC-barrel domain [50346] (5 families) (S)
  5. 2791579Family b.41.1.2: MTH1895 [101773] (1 protein)
    homodimeric protein; subunits are composed of a stand-alone copy of this domain
    automatically mapped to Pfam PF05239
  6. 2791580Protein MTH1895 [101774] (1 species)
  7. 2791581Species Methanobacterium thermoautotrophicum [TaxId:145262] [101775] (1 PDB entry)
  8. 2791583Domain d1pm3b1: 1pm3 B:1-76 [94890]
    Other proteins in same PDB: d1pm3a2, d1pm3b2
    structural genomics

Details for d1pm3b1

PDB Entry: 1pm3 (more details), 3.15 Å

PDB Description: mth1859
PDB Compounds: (B:) mth1895

SCOPe Domain Sequences for d1pm3b1:

Sequence, based on SEQRES records: (download)

>d1pm3b1 b.41.1.2 (B:1-76) MTH1895 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mriveemvgkevldssakvigkvkdvevdiesqaieslvlgkggiseglglskgetivpy
emvkkigdkillkgpe

Sequence, based on observed residues (ATOM records): (download)

>d1pm3b1 b.41.1.2 (B:1-76) MTH1895 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mriveemvgkevldssakvigkvkdvevdiesqaieslvlgkgkgetivpyemvkkigdk
illkgpe

SCOPe Domain Coordinates for d1pm3b1:

Click to download the PDB-style file with coordinates for d1pm3b1.
(The format of our PDB-style files is described here.)

Timeline for d1pm3b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pm3b2