SCOPe 2.04: Domain d1pm3a_: 1pm3 A:

Lineage for d1pm3a_ (1pm3 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.2: MTH1895 [101773] (1 protein)
   homodimeric protein; subunits are composed of a stand-alone copy of this domain
   automatically mapped to Pfam PF05239

6. Protein MTH1895 [101774] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [101775] (1 PDB entry)

8. Domain d1pm3a_: 1pm3 A: [94889]
   structural genomics

Details for d1pm3a_

PDB Entry: 1pm3, 3.15 Å

PDB Description: mth1859

PDB Compounds: (A:) mth1895

SCOPe Domain Sequences for d1pm3a_:

Sequence, based on SEQRES records:

>d1pm3a_ b.41.1.2 (A:) MTH1895 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
hmriveemvgkevldssakvigkvkdvevdiesqaieslvlgkggiseglglskgetivp
yemvkkigdkillkgpee

Sequence, based on observed residues (ATOM records):

>d1pm3a_ b.41.1.2 (A:) MTH1895 {Methanobacterium thermoautotrophicum [TaxId: 145262]}
hmriveemvgkevldssakvigkvkdvevdiesqaieslvlgkgggetivpyemvkkigd
killkgpee

Timeline for d1pm3a_:

• d1pm3a_ first appeared in SCOP 1.67
  
• d1pm3a_ appears in SCOPe 2.03
  
• d1pm3a_ appears in SCOPe 2.05
  
• d1pm3a_ appears in the current release, SCOPe 2.08, called d1pm3a1