| Class b: All beta proteins [48724] (144 folds) |
| Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
Superfamily b.41.1: PRC-barrel domain [50346] (3 families) ![]() |
| Family b.41.1.2: MTH1895 [101773] (1 protein) homodimeric protein; subunits are composed of a stand-alone copy of this domain |
| Protein MTH1895 [101774] (1 species) |
| Species Archaeon Methanobacterium thermoautotrophicum [TaxId:145262] [101775] (1 PDB entry) |
| Domain d1pm3a_: 1pm3 A: [94889] |
PDB Entry: 1pm3 (more details), 3.15 Å
SCOP Domain Sequences for d1pm3a_:
Sequence, based on SEQRES records: (download)
>d1pm3a_ b.41.1.2 (A:) MTH1895 {Archaeon Methanobacterium thermoautotrophicum}
hmriveemvgkevldssakvigkvkdvevdiesqaieslvlgkggiseglglskgetivp
yemvkkigdkillkgpee
>d1pm3a_ b.41.1.2 (A:) MTH1895 {Archaeon Methanobacterium thermoautotrophicum}
hmriveemvgkevldssakvigkvkdvevdiesqaieslvlgkgggetivpyemvkkigd
killkgpee
Timeline for d1pm3a_: