![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.41: PRC-barrel domain [50345] (1 superfamily) core: barrel, partly opened; n*=5, S*=8; meander |
![]() | Superfamily b.41.1: PRC-barrel domain [50346] (5 families) ![]() |
![]() | Family b.41.1.2: MTH1895 [101773] (1 protein) homodimeric protein; subunits are composed of a stand-alone copy of this domain automatically mapped to Pfam PF05239 |
![]() | Protein MTH1895 [101774] (1 species) |
![]() | Species Methanobacterium thermoautotrophicum [TaxId:145262] [101775] (1 PDB entry) |
![]() | Domain d1pm3a1: 1pm3 A:1-77 [94889] Other proteins in same PDB: d1pm3a2, d1pm3b2 structural genomics |
PDB Entry: 1pm3 (more details), 3.15 Å
SCOPe Domain Sequences for d1pm3a1:
Sequence, based on SEQRES records: (download)
>d1pm3a1 b.41.1.2 (A:1-77) MTH1895 {Methanobacterium thermoautotrophicum [TaxId: 145262]} mriveemvgkevldssakvigkvkdvevdiesqaieslvlgkggiseglglskgetivpy emvkkigdkillkgpee
>d1pm3a1 b.41.1.2 (A:1-77) MTH1895 {Methanobacterium thermoautotrophicum [TaxId: 145262]} mriveemvgkevldssakvigkvkdvevdiesqaieslvlgkgggetivpyemvkkigdk illkgpee
Timeline for d1pm3a1: