Lineage for d1pm2b_ (1pm2 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703310Family a.25.1.2: Ribonucleotide reductase-like [47253] (9 proteins)
  6. 2703463Protein Ribonucleotide reductase R2 [47257] (10 species)
  7. 2703497Species Escherichia coli [TaxId:562] [47258] (24 PDB entries)
  8. 2703507Domain d1pm2b_: 1pm2 B: [94888]
    complexed with hg, mn; mutant

Details for d1pm2b_

PDB Entry: 1pm2 (more details), 1.8 Å

PDB Description: crystal structure of manganese substituted r2-d84e (d84e mutant of the r2 subunit of e. coli ribonucleotide reductase)
PDB Compounds: (B:) Ribonucleoside-diphosphate reductase 1 beta chain

SCOPe Domain Sequences for d1pm2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pm2b_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtllesiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfntrsnpipwintwl

SCOPe Domain Coordinates for d1pm2b_:

Click to download the PDB-style file with coordinates for d1pm2b_.
(The format of our PDB-style files is described here.)

Timeline for d1pm2b_: