SCOP 1.67: Domain d1pm2a_: 1pm2 A:

Lineage for d1pm2a_ (1pm2 A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (3 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins)

6. Protein Ribonucleotide reductase R2 [47257] (6 species)

7. Species Escherichia coli [TaxId:562] [47258] (21 PDB entries)

8. Domain d1pm2a_: 1pm2 A: [94887]

Details for d1pm2a_

PDB Entry: 1pm2, 1.8 Å

PDB Description: crystal structure of manganese substituted r2-d84e (d84e mutant of the r2 subunit of e. coli ribonucleotide reductase)

SCOP Domain Sequences for d1pm2a_:

Sequence; same for both SEQRES and ATOM records:

>d1pm2a_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtllesiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfntrsnpipwintwl

Timeline for d1pm2a_:

• d1pm2a_ is new in SCOP 1.67
  
• d1pm2a_ appears in SCOP 1.69
  
• d1pm2a_ appears in the current release, SCOPe 2.08