Class g: Small proteins [56992] (92 folds) |
Fold g.7: Snake toxin-like [57301] (1 superfamily) disulfide-rich fold: nearly all-beta |
Superfamily g.7.1: Snake toxin-like [57302] (4 families) |
Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins) |
Protein TGF-beta type II receptor extracellular domain [69951] (2 species) elaborated with additional structures resulting in a beta-sandwich fold |
Species Human (Homo sapiens) [TaxId:9606] [69952] (7 PDB entries) |
Domain d1ploa_: 1plo A: [94886] |
PDB Entry: 1plo (more details)
SCOPe Domain Sequences for d1ploa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ploa_ g.7.1.3 (A:) TGF-beta type II receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} vtdnagavkfpqlckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitl etvchdpklpyhdfiledaaspkcimkekkkpgetffmcscssdecndniifseeyntsn pd
Timeline for d1ploa_: