Lineage for d1ploa_ (1plo A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2583547Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2583548Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2583778Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 2583818Protein TGF-beta type II receptor extracellular domain [69951] (2 species)
    elaborated with additional structures resulting in a beta-sandwich fold
  7. 2583821Species Human (Homo sapiens) [TaxId:9606] [69952] (9 PDB entries)
  8. 2583833Domain d1ploa_: 1plo A: [94886]

Details for d1ploa_

PDB Entry: 1plo (more details)

PDB Description: transforming growth factor-beta type ii receptor extracellular domain
PDB Compounds: (A:) TGF-beta receptor type II

SCOPe Domain Sequences for d1ploa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ploa_ g.7.1.3 (A:) TGF-beta type II receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
vtdnagavkfpqlckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitl
etvchdpklpyhdfiledaaspkcimkekkkpgetffmcscssdecndniifseeyntsn
pd

SCOPe Domain Coordinates for d1ploa_:

Click to download the PDB-style file with coordinates for d1ploa_.
(The format of our PDB-style files is described here.)

Timeline for d1ploa_: