![]() | Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) ![]() |
![]() | Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (12 proteins) N-terminal all-beta domain defines family |
![]() | Protein Ketose reductase (sorbitol dehydrogenase) [51745] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102130] (3 PDB entries) |
![]() | Domain d1pl7c2: 1pl7 C:146-316 [94875] Other proteins in same PDB: d1pl7a1, d1pl7b1, d1pl7c1, d1pl7d1 |
PDB Entry: 1pl7 (more details), 2.2 Å
SCOP Domain Sequences for d1pl7c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pl7c2 c.2.1.1 (C:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens)} vtfeegalieplsvgihacrrggvtlghkvlvcgagpigmvtllvakamgaaqvvvtdls atrlskakeigadlvlqiskespqeiarkvegqlgckpevtiectgaeasiqagiyatrs ggtlvlvglgsemttvpllhaairevdikgvfrycntwpvaismlasksvn
Timeline for d1pl7c2: