SCOPe 2.08: Domain d1pl7b2: 1pl7 B:146-316

Lineage for d1pl7b2 (1pl7 B:146-316)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (19 proteins)
   N-terminal all-beta domain defines family

6. Protein Ketose reductase (sorbitol dehydrogenase) [51745] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [102130] (3 PDB entries)

8. Domain d1pl7b2: 1pl7 B:146-316 [94873]
   Other proteins in same PDB: d1pl7a1, d1pl7b1, d1pl7c1, d1pl7d1
   complexed with zn

Details for d1pl7b2

PDB Entry: 1pl7, 2.2 Å

PDB Description: Human Sorbitol Dehydrogenase (apo)

PDB Compounds: (B:) sorbitol dehydrogenase

SCOPe Domain Sequences for d1pl7b2:

Sequence; same for both SEQRES and ATOM records:

>d1pl7b2 c.2.1.1 (B:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]}
vtfeegalieplsvgihacrrggvtlghkvlvcgagpigmvtllvakamgaaqvvvtdls
atrlskakeigadlvlqiskespqeiarkvegqlgckpevtiectgaeasiqagiyatrs
ggtlvlvglgsemttvpllhaairevdikgvfrycntwpvaismlasksvn

Timeline for d1pl7b2:

• d1pl7b2 first appeared in SCOP 1.67
  
• d1pl7b2 appears in SCOPe 2.07