Lineage for d1pl7b1 (1pl7 B:1-145,B:317-356)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 666133Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 666134Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 666255Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 666524Protein Ketose reductase (sorbitol dehydrogenase) [50145] (2 species)
  7. 666525Species Human (Homo sapiens) [TaxId:9606] [101710] (3 PDB entries)
  8. 666527Domain d1pl7b1: 1pl7 B:1-145,B:317-356 [94872]
    Other proteins in same PDB: d1pl7a2, d1pl7b2, d1pl7c2, d1pl7d2

Details for d1pl7b1

PDB Entry: 1pl7 (more details), 2.2 Å

PDB Description: Human Sorbitol Dehydrogenase (apo)
PDB Compounds: (B:) sorbitol dehydrogenase

SCOP Domain Sequences for d1pl7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pl7b1 b.35.1.2 (B:1-145,B:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]}
aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
tppddgnlcrfykhnaafcyklpdnXvkplvthrfplekaleafetfkkglglkimlkcd
psdqnp

SCOP Domain Coordinates for d1pl7b1:

Click to download the PDB-style file with coordinates for d1pl7b1.
(The format of our PDB-style files is described here.)

Timeline for d1pl7b1: