![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.35: GroES-like [50128] (2 superfamilies) contains barrel, partly opened; n*=4, S*=8; meander |
![]() | Superfamily b.35.1: GroES-like [50129] (3 families) ![]() |
![]() | Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins) C-terminal domain is alpha/beta (classical Rossmann-fold) |
![]() | Protein Ketose reductase (sorbitol dehydrogenase) [50145] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101710] (3 PDB entries) |
![]() | Domain d1pl6b1: 1pl6 B:1-145,B:317-356 [94864] Other proteins in same PDB: d1pl6a2, d1pl6b2, d1pl6c2, d1pl6d2 complexed with 572, nad, zn |
PDB Entry: 1pl6 (more details), 2 Å
SCOPe Domain Sequences for d1pl6b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pl6b1 b.35.1.2 (B:1-145,B:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca tppddgnlcrfykhnaafcyklpdnXvkplvthrfplekaleafetfkkglglkimlkcd psdqnp
Timeline for d1pl6b1: