Lineage for d1pl6b1 (1pl6 B:1-145,B:317-356)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373088Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 373089Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 373153Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (11 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 373373Protein Ketose reductase (sorbitol dehydrogenase) [50145] (2 species)
  7. 373374Species Human (Homo sapiens) [TaxId:9606] [101710] (3 PDB entries)
  8. 373384Domain d1pl6b1: 1pl6 B:1-145,B:317-356 [94864]
    Other proteins in same PDB: d1pl6a2, d1pl6b2, d1pl6c2, d1pl6d2

Details for d1pl6b1

PDB Entry: 1pl6 (more details), 2 Å

PDB Description: Human SDH/NADH/inhibitor complex

SCOP Domain Sequences for d1pl6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pl6b1 b.35.1.2 (B:1-145,B:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens)}
aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
tppddgnlcrfykhnaafcyklpdnXvkplvthrfplekaleafetfkkglglkimlkcd
psdqnp

SCOP Domain Coordinates for d1pl6b1:

Click to download the PDB-style file with coordinates for d1pl6b1.
(The format of our PDB-style files is described here.)

Timeline for d1pl6b1: