Lineage for d1pl6a1 (1pl6 A:1-145,A:317-356)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2055849Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 2055850Superfamily b.35.1: GroES-like [50129] (3 families) (S)
  5. 2055978Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (15 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 2056276Protein Ketose reductase (sorbitol dehydrogenase) [50145] (2 species)
  7. 2056277Species Human (Homo sapiens) [TaxId:9606] [101710] (3 PDB entries)
  8. 2056282Domain d1pl6a1: 1pl6 A:1-145,A:317-356 [94862]
    Other proteins in same PDB: d1pl6a2, d1pl6b2, d1pl6c2, d1pl6d2
    complexed with 572, nad, zn

Details for d1pl6a1

PDB Entry: 1pl6 (more details), 2 Å

PDB Description: Human SDH/NADH/inhibitor complex
PDB Compounds: (A:) sorbitol dehydrogenase

SCOPe Domain Sequences for d1pl6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pl6a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]}
aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
tppddgnlcrfykhnaafcyklpdnXvkplvthrfplekaleafetfkkglglkimlkcd
psdqnp

SCOPe Domain Coordinates for d1pl6a1:

Click to download the PDB-style file with coordinates for d1pl6a1.
(The format of our PDB-style files is described here.)

Timeline for d1pl6a1: