SCOP 1.71: Domain d1pl4d2: 1pl4 D:84-197

Lineage for d1pl4d2 (1pl4 D:84-197)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (14 PDB entries)

8. Domain d1pl4d2: 1pl4 D:84-197 [94861]
   Other proteins in same PDB: d1pl4a1, d1pl4b1, d1pl4c1, d1pl4d1
   complexed with mn; mutant

Details for d1pl4d2

PDB Entry: 1pl4, 1.47 Å

PDB Description: crystal structure of human mnsod y166f mutant

SCOP Domain Sequences for d1pl4d2:

Sequence; same for both SEQRES and ATOM records:

>d1pl4d2 d.44.1.1 (D:84-197) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayflqyknvrpdylkaiwnvinwenvterymack

Timeline for d1pl4d2:

• d1pl4d2 first appeared in SCOP 1.67
  
• d1pl4d2 appears in SCOP 1.69
  
• d1pl4d2 appears in SCOP 1.73
  
• d1pl4d2 appears in the current release, SCOPe 2.08