Lineage for d1pl4c1 (1pl4 C:1-83)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 437311Fold a.2: Long alpha-hairpin [46556] (14 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 437446Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 437447Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 437559Protein Mn superoxide dismutase (MnSOD) [46618] (6 species)
  7. 437603Species Human (Homo sapiens) [TaxId:9606] [46619] (14 PDB entries)
  8. 437606Domain d1pl4c1: 1pl4 C:1-83 [94858]
    Other proteins in same PDB: d1pl4a2, d1pl4b2, d1pl4c2, d1pl4d2

Details for d1pl4c1

PDB Entry: 1pl4 (more details), 1.47 Å

PDB Description: crystal structure of human mnsod y166f mutant

SCOP Domain Sequences for d1pl4c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pl4c1 a.2.11.1 (C:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOP Domain Coordinates for d1pl4c1:

Click to download the PDB-style file with coordinates for d1pl4c1.
(The format of our PDB-style files is described here.)

Timeline for d1pl4c1: