SCOP 1.73: Domain d1pl4b2: 1pl4 B:84-196

Lineage for d1pl4b2 (1pl4 B:84-196)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (23 PDB entries)

8. Domain d1pl4b2: 1pl4 B:84-196 [94857]
   Other proteins in same PDB: d1pl4a1, d1pl4b1, d1pl4c1, d1pl4d1

Details for d1pl4b2

PDB Entry: 1pl4, 1.47 Å

PDB Description: crystal structure of human mnsod y166f mutant

PDB Compounds: (B:) Superoxide dismutase [Mn], mitochondrial

SCOP Domain Sequences for d1pl4b2:

Sequence; same for both SEQRES and ATOM records:

>d1pl4b2 d.44.1.1 (B:84-196) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayflqyknvrpdylkaiwnvinwenvterymac

Timeline for d1pl4b2:

• d1pl4b2 first appeared in SCOP 1.67
  
• d1pl4b2 appears in SCOP 1.71
  
• d1pl4b2 appears in SCOP 1.75
  
• d1pl4b2 appears in the current release, SCOPe 2.08