SCOP 1.67: Domain d1pl4b1: 1pl4 B:1-83

Lineage for d1pl4b1 (1pl4 B:1-83)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.2: Long alpha-hairpin [46556] (12 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family)

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [46618] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46619] (14 PDB entries)

8. Domain d1pl4b1: 1pl4 B:1-83 [94856]
   Other proteins in same PDB: d1pl4a2, d1pl4b2, d1pl4c2, d1pl4d2

Details for d1pl4b1

PDB Entry: 1pl4, 1.47 Å

PDB Description: crystal structure of human mnsod y166f mutant

SCOP Domain Sequences for d1pl4b1:

Sequence; same for both SEQRES and ATOM records:

>d1pl4b1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

Timeline for d1pl4b1:

• d1pl4b1 is new in SCOP 1.67
  
• d1pl4b1 appears in SCOP 1.69
  
• d1pl4b1 appears in the current release, SCOPe 2.08