SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1pl4a1 (1pl4 A:1-83)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1979497Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 1979785Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 1979786Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 protein domains)
  6. 1979912Protein Mn superoxide dismutase (MnSOD) [46618] (9 species)
  7. 1979976Species Human (Homo sapiens) [TaxId:9606] [46619] (27 PDB entries)
  8. 1979983Domain d1pl4a1: 1pl4 A:1-83 [94854]
    Other proteins in same PDB: d1pl4a2, d1pl4b2, d1pl4c2, d1pl4d2
    complexed with mn; mutant

Details for d1pl4a1

PDB Entry: 1pl4 (more details), 1.47 Å

PDB Description: Crystal Structure of human MnSOD Y166F mutant
PDB Compounds: (A:) Superoxide dismutase [Mn], mitochondrial

SCOPe Domain Sequences for d1pl4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pl4a1 a.2.11.1 (A:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOPe Domain Coordinates for d1pl4a1:

Click to download the PDB-style file with coordinates for d1pl4a1.
(The format of our PDB-style files is described here.)

Timeline for d1pl4a1: