Lineage for d1pl0c1 (1pl0 C:5-200)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859565Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859566Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) (S)
    contains a common phosphate-binding site
  5. 2859656Family c.24.1.3: Inosicase [63971] (1 protein)
  6. 2859657Protein IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC [63972] (3 species)
  7. 2859679Species Human (Homo sapiens) [TaxId:9606] [102255] (3 PDB entries)
  8. 2859688Domain d1pl0c1: 1pl0 C:5-200 [94850]
    Other proteins in same PDB: d1pl0a2, d1pl0b2, d1pl0c2, d1pl0d2
    complexed with amz, bw2, k, xmp

Details for d1pl0c1

PDB Entry: 1pl0 (more details), 2.6 Å

PDB Description: Crystal structure of human ATIC in complex with folate-based inhibitor, BW2315U89UC
PDB Compounds: (C:) Bifunctional purine biosynthesis protein PURH

SCOPe Domain Sequences for d1pl0c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pl0c1 c.24.1.3 (C:5-200) IMP cyclohydrolase domain of bifunctional purine biosynthesis enzyme ATIC {Human (Homo sapiens) [TaxId: 9606]}
qlalfsvsdktglvefarnltalglnlvasggtakalrdaglavrdvseltgfpemlggr
vktlhpavhagilarnipednadmarldfnlirvvacnlypfvktvaspgvtveeaveqi
diggvtllraaaknharvtvvcepedyvvvstemqsseskdtsletrrqlalkafthtaq
ydeaisdyfrkqyskg

SCOPe Domain Coordinates for d1pl0c1:

Click to download the PDB-style file with coordinates for d1pl0c1.
(The format of our PDB-style files is described here.)

Timeline for d1pl0c1: